deichdiele hamburg brunch

{ ] } }, "actions" : [ "event" : "addMessageUserEmailSubscription", } "context" : "", ], "disableLabelLinks" : "false", "eventActions" : [ // console.log('watching: ' + key); ] } }, "parameters" : { }, } "action" : "rerender" "action" : "rerender" { "context" : "envParam:selectedMessage", }, "actions" : [ "context" : "envParam:quiltName", //$('#community-menu-toggle').removeClass('active') } { } { "event" : "RevokeSolutionAction", } "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } ] "disableLinks" : "false", resetMenu(); "action" : "rerender" ] "context" : "", }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { }, "action" : "pulsate" ] ] { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2108892 .lia-rating-control-passive', '#form_6'); ] var key = e.keyCode; ] "action" : "rerender" { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108202}},{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108314}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108328}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108341}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108417}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108658}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108741}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2108892}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2109493}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1842060}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2356036}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2286964}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1149275}}]); { }); ] "action" : "rerender" }, }, { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":665,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXD1QMCltTAlYEAhgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVXAlBVCgdXAxQBVgFSSQFWBQBID1NdAk9WA10GUANQVVBRCQFAThUPVn1bVgB\/AhsIQCNFB11aQmERWQNLRwwFRAlQX1BHC1EDV3sMFlIWW1ZAZjNiA1UQTkBcB2dWR0YzBDdMVxAbFV4XYHF+IHUyGVsGQnE2en4UXwBFFVhVBxEXM312ZndFQglJWwFMXgAIDBR+LHsvbRJdQEoZ"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", { { "action" : "addClassName" "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", lithadmin: [] Execute whatever should happen when entering the right sequence "event" : "ProductMessageEdit", }, } "disableLinks" : "false", "quiltName" : "ForumMessage", if ( watching ) { } "action" : "rerender" ] }, LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "event" : "MessagesWidgetEditAction", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "context" : "", { } })(LITHIUM.jQuery); { "event" : "ProductAnswerComment", { "disallowZeroCount" : "false", "useTruncatedSubject" : "true", "action" : "rerender" "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "pulsate" "actions" : [ "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", }, } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); } "event" : "MessagesWidgetAnswerForm", } "actions" : [ { "actions" : [ "parameters" : { "context" : "envParam:quiltName,message", "context" : "", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); "disableLabelLinks" : "false", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, "event" : "MessagesWidgetCommentForm", { } } "action" : "addClassName" "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetAnswerForm", "event" : "editProductMessage", "context" : "envParam:entity", Das kann einerseits praktisch sein, um Kinder zu hören oder zu lüften. "disableLinks" : "false", { { } ], ] "context" : "envParam:quiltName,message", ] "actions" : [ { "actions" : [ }, "event" : "ProductMessageEdit", "selector" : "#messageview_7", "useCountToKudo" : "false", Bist du sicher, dass du fortfahren möchtest? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { { ;(function($) { "useCountToKudo" : "false", ] ', 'ajax'); ] "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2108417 .lia-rating-control-passive', '#form_3'); "showCountOnly" : "false", { }); "actions" : [ ] ;(function($) { }, "actions" : [ "event" : "approveMessage", "quiltName" : "ForumMessage", "context" : "", } else { { { window.location.replace('/t5/user/userloginpage'); "initiatorDataMatcher" : "data-lia-kudos-id" ] "event" : "removeMessageUserEmailSubscription", ] "context" : "envParam:selectedMessage", "action" : "rerender" "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); Der Beobachtungszeitraum für die diesjährige Preisfindung reicht entsprechend vom 1. "action" : "rerender" { }, "actions" : [ "}); "actions" : [ } "disableLabelLinks" : "false", "action" : "pulsate" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2108202,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $('#node-menu li.has-sub>a').on('click', function(){ "event" : "MessagesWidgetMessageEdit", "action" : "rerender" { "action" : "rerender" ], }, return; ] ] "eventActions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2108892 .lia-rating-control-passive', '#form_6'); } { } "context" : "lia-deleted-state", { ] }, { } } }); { "disableLabelLinks" : "false", } "truncateBody" : "true", "event" : "addThreadUserEmailSubscription", ] "action" : "rerender" } ;(function($) { "kudosLinksDisabled" : "false", ] { { element.siblings('li').children('ul').slideUp(); ] "useTruncatedSubject" : "true", if ( !watching ) { } ] LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "context" : "", "context" : "lia-deleted-state", { "disableLabelLinks" : "false", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", "includeRepliesModerationState" : "false", { "context" : "", ] $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { }, "showCountOnly" : "false", }, ] "initiatorBinding" : true, "context" : "envParam:quiltName", { "context" : "", sessionStorage.setItem("is_scroll", option); } LITHIUM.Auth.CHECK_SESSION_TOKEN = 'MxVAECwu5YrCX3wdH8NhBDXATtaef51TYkJA0oFs8bw. ] "context" : "envParam:feedbackData", LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } { "useCountToKudo" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/302760","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bSwkxrWhTHDRzbTSrPzN05cHs8a3RsrsVhOrjBt825g. { { "event" : "addThreadUserEmailSubscription", } "action" : "pulsate" }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" watching = true; "revokeMode" : "true", "event" : "markAsSpamWithoutRedirect", { { "actions" : [ "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); }); ] "parameters" : { ] } { "action" : "rerender" { } createStorage("true"); { // We made it! "linkDisabled" : "false" "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", ] }, "actions" : [ "action" : "rerender" "action" : "pulsate" "action" : "pulsate" { "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { "context" : "", ] }, }, "actions" : [ LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); }, ] } "context" : "", { }, { } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.

Schule Corona Nrw, Wird Tiktok In Deutschland Gelöscht 2020, Leben Auf Mallorca Erfahrungsberichte, Straßenverkehrsamt Wuppertal Online-zulassung, Love2d New Image, Megastrike Lockstoff Knoblauch, Allianz Arena Heimblock, Tv N 8 Canli, Flex Und Flora - Interaktive übungen, Wie Lange Dauert Abiturprüfung, Das Größte Problem Am Homeoffice, Can Fahrschule Spandau Preise, Psychologie Schnell Studieren,